FCN3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of FCN3 expression in transfected 293T cell line (H00008547-T02) by FCN3 MaxPab polyclonal antibody.
Lane 1: FCN3 transfected lysate(31.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FCN3 protein.
Immunogen
FCN3 (AAH20731.1, 1 a.a. ~ 288 a.a) full-length human protein.
Sequence
MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FCN3 expression in transfected 293T cell line (H00008547-T02) by FCN3 MaxPab polyclonal antibody.
Lane 1: FCN3 transfected lysate(31.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FCN3
Entrez GeneID
8547GeneBank Accession#
NM_173452.1Protein Accession#
AAH20731.1Gene Name
FCN3
Gene Alias
FCNH, HAKA1, MGC22543
Gene Description
ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
Omim ID
604973Gene Ontology
HyperlinkGene Summary
Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. The protein encoded by this gene is a thermolabile beta-2-macroglycoprotein found in all human serum and is a member of the ficolin/opsonin p35 lectin family. The protein, which was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus, has been shown to have a calcium-independent lectin activity. The protein can activate the complement pathway in association with MASPs and sMAP, thereby aiding in host defense through the activation of the lectin pathway. Alternative splicing occurs at this locus and two variants, each encoding a distinct isoform, have been identified. [provided by RefSeq
Other Designations
H-ficolin|Hakata antigen|OTTHUMP00000006338|OTTHUMP00000006339|collagen/fibrinogen domain-containing lectin 3 p35|collagen/fibrinogen domain-containing protein 3|ficolin 3|ficolin-3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com