KLF11 monoclonal antibody (M01), clone 8F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KLF11.
Immunogen
KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KLF11 monoclonal antibody (M01), clone 8F4 Western Blot analysis of KLF11 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KLF11 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KLF11 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to KLF11 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — KLF11
-
Interactome
-
Disease
-
Publication Reference
-
KLF11 Protects against Venous Thrombosis via Suppressing Tissue Factor Expression.
Wenying Liang, Haocheng Lu, Jinjian Sun, Guizhen Zhao, Huilun Wang, Yanhong Guo, Daniel Eitzman, Y Eugene Chen, Yanbo Fan and Jifeng Zhang.
Research and Practice in Thrombosis and Haemostasis 2022 May; 122(5):777.
Application:CoIP, WB-Ce, Human, HUVEC cells.
-
Laminar Flow Attenuates Macrophage Migration Inhibitory Factor Expression in Endothelial Cells.
Qiao C, Li S, Lu H, Meng F, Fan Y, Guo Y, Chen YE, Zhang J.
Scientific Reports 2018 Feb; 8:2360.
Application:WB-Ce, Human, HCAECs cells.
-
Epigenetic Regulation of Uterine Biology by Transcription Factor KLF11 via Post-translational Histone Deacetylation of Cytochrome p450 Metabolic Enzymes.
Zheng Y, Tabbaa ZM, Khan Z, Schoolmeester JK, El-Nashar S, Famuyide A, Keeney GL, Daftary GS.
Endocrinology 2014 Nov; 155(11):4507.
Application:IF, IHC, WB-Tr, Human, Endometrium, Ishikawa cells.
-
A Novel Role of the Sp/KLF Transcription Factor KLF11 in Arresting Progression of Endometriosis.
Daftary GS, Zheng Y, Tabbaa ZM, Schoolmeester JK, Gada RP, Grzenda AL, Mathison AJ, Keeney GL, Lomberk GA, Urrutia R.
PLoS One 2013 Mar; 8(3):e60165.
Application:IHC-P, WB, Human, Ishikawa, T-HESC cells, Patients with a histologic diagnosis of endometriosis.
-
KLF11 Protects against Venous Thrombosis via Suppressing Tissue Factor Expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com