DYRK2 monoclonal antibody (M01), clone 3G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DYRK2.
Immunogen
DYRK2 (AAH05809, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DYRK2 expression in transfected 293T cell line by DYRK2 monoclonal antibody (M01), clone 3G5.
Lane 1: DYRK2 transfected lysate(59.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DYRK2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — DYRK2
Entrez GeneID
8445GeneBank Accession#
BC005809Protein Accession#
AAH05809Gene Name
DYRK2
Gene Alias
FLJ21217, FLJ21365
Gene Description
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
Omim ID
603496Gene Ontology
HyperlinkGene Summary
DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine residues. DYRK2 has demonstrated tyrosine autophosphorylation and catalyzed phosphorylation of histones H3 and H2B in vitro. Two isoforms of DYRK2 have been isolated. The predominant isoform, isoform 1, lacks a 5' terminal insert. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com