CDK2AP1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CDK2AP1 protein.
Immunogen
CDK2AP1 (AAH34717.1, 1 a.a. ~ 115 a.a) full-length human protein.
Sequence
MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDK2AP1 expression in transfected 293T cell line (H00008099-T03) by CDK2AP1 MaxPab polyclonal antibody.
Lane 1: CDK2AP1 transfected lysate(12.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CDK2AP1
Entrez GeneID
8099GeneBank Accession#
NM_004642Protein Accession#
AAH34717.1Gene Name
CDK2AP1
Gene Alias
DOC1, DORC1, ST19, doc-1, p12DOC-1
Gene Description
cyclin-dependent kinase 2 associated protein 1
Omim ID
602198Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a specific CDK2-associated protein, which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggested the regulatory role in DNA replication during S phase of the cell cycle. A similar gene in hamster was isolated from, and functions as a growth suppressor of normal keratinocytes. [provided by RefSeq
Other Designations
CDK2-associated protein 1|CDK2-associated protein 1|Deleted in oral cancer-1|cyclin-dependent kinase 2-associated protein 1|putative oral cancer suppressor
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com