Product Browser

Last updated: 2014/10/20
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDK2AP1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00008099-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CDK2AP1 protein.
  • Immunogen:
  • CDK2AP1 (AAH34717, 1 a.a. ~ 115 a.a) full-length human protein.
  • Sequence:
  • MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CDK2AP1 expression in transfected 293T cell line (H00008099-T01) by CDK2AP1 MaxPab polyclonal antibody.

    Lane 1: CDK2AP1 transfected lysate(12.76 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 8099
  • Gene Name:
  • CDK2AP1
  • Gene Alias:
  • DOC1,DORC1,ST19,doc-1,p12DOC-1
  • Gene Description:
  • cyclin-dependent kinase 2 associated protein 1
  • Gene Summary:
  • The protein encoded by this gene is a specific CDK2-associated protein, which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggested the regulatory role in DNA replication during S phase of the cell cycle. A similar gene in hamster was isolated from, and functions as a growth suppressor of normal keratinocytes. [provided by RefSeq
  • Other Designations:
  • CDK2-associated protein 1,CDK2-associated protein 1,Deleted in oral cancer-1,cyclin-dependent kinase 2-associated protein 1,putative oral cancer suppressor
  • RSS
  • YouTube
  • Linkedin
  • Facebook