ADAM12 monoclonal antibody (M01), clone 1G3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ADAM12 expression in transfected 293T cell line by ADAM12 monoclonal antibody (M01), clone 1G3.
Lane 1: ADAM12 transfected lysate (Predicted MW: 80.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADAM12 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ADAM12.
Immunogen
ADAM12 (NP_003465, 208 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ADAM12 expression in transfected 293T cell line by ADAM12 monoclonal antibody (M01), clone 1G3.
Lane 1: ADAM12 transfected lysate (Predicted MW: 80.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADAM12 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — ADAM12
Entrez GeneID
8038GeneBank Accession#
NM_003474Protein Accession#
NP_003465Gene Name
ADAM12
Gene Alias
MCMP, MCMPMltna, MLTN, MLTNA
Gene Description
ADAM metallopeptidase domain 12
Omim ID
602714Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene has two alternatively spliced transcripts: a shorter secreted form and a longer membrane-bound form. The shorter form is found to stimulate myogenesis. [provided by RefSeq
Other Designations
OTTHUMP00000020727|OTTHUMP00000046766|a disintegrin and metalloproteinase domain 12 (meltrin alpha)|meltrin alpha
-
Interactome
-
Disease
-
Publication Reference
-
TM4SF3 promotes esophageal carcinoma metastasis via upregulating ADAM12m expression.
Zhou Z, Ran YL, Hu H, Pan J, Li ZF, Chen LZ, Sun LC, Peng L, Zhao XL, Yu L, Sun LX, Yang ZH.
Clinical & Experimental Metastasis 2008 Mar; 25(5):537.
Application：WB, Human, Human esophageal carcinoma cell line EC9706, and KYSE150 cells.
-
TM4SF3 promotes esophageal carcinoma metastasis via upregulating ADAM12m expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com