EPM2A monoclonal antibody (M01), clone 4A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EPM2A monoclonal antibody (M01), clone 4A12. Western Blot analysis of EPM2A expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPM2A is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPM2A.
Immunogen
EPM2A (NP_001018051, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GNGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIV
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EPM2A monoclonal antibody (M01), clone 4A12. Western Blot analysis of EPM2A expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPM2A is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — EPM2A
Entrez GeneID
7957GeneBank Accession#
NM_001018041Protein Accession#
NP_001018051Gene Name
EPM2A
Gene Alias
EPM2, MELF
Gene Description
epilepsy, progressive myoclonus type 2A, Lafora disease (laforin)
Gene Ontology
HyperlinkGene Summary
This gene encodes a dual-specificity phosphatase that associates with polyribosomes. The encoded protein may be involved in the regulation of glycogen metabolism. Mutations in this gene have been associated with myoclonic epilepsy of Lafora. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000017360|epilepsy, progressive myoclonus type 2, Lafora disease (laforin)|laforin
-
Interactome
-
Disease
-
Publication Reference
-
A Bioassay for Lafora Disease and Laforin Glucan Phosphatase Activity.
Sherwood AR, Johnson MB, Delgado-Escueta AV, Gentry MS.
Clinical Biochemistry 2013 Dec; 46(18):1869.
Application：IP, WB-Ti, Mouse, Recombinant protein, Skeletal muscle.
-
A Bioassay for Lafora Disease and Laforin Glucan Phosphatase Activity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com