Product Browser

Last updated: 2014/10/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCR4 monoclonal antibody (M04), clone 2G9

  • Catalog # : H00007852-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CXCR4.
  • Immunogen:
  • CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007852-M04
    Western Blot detection against Immunogen (30.8 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in human colon.
  • Protocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in human intestinal wall.
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CXCR4 monoclonal antibody (M04), clone 2G9. Western Blot analysis of CXCR4 expression in RIN-m5F.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CXCR4 expression in transfected 293T cell line by CXCR4 monoclonal antibody (M04), clone 2G9.

    Lane 1: CXCR4 transfected lysate (Predicted MW: 39.7 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged CXCR4 is 0.03 ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7852
  • Gene Name:
  • CXCR4
  • Gene Alias:
  • CD184,D2S201E,FB22,HM89,HSY3RR,LAP3,LCR1,LESTR,NPY3R,NPYR,NPYRL,NPYY3R,WHIM
  • Gene Description:
  • chemokine (C-X-C motif) receptor 4
  • Gene Summary:
  • This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • C-X-C chemokine receptor type 4,CD184 antigen,chemokine (C-X-C motif), receptor 4 (fusin),chemokine receptor 4,fusin,leukocyte-derived seven-transmembrane-domain receptor,lipopolysaccharide-associated protein 3,neuropeptide Y receptor Y3,seven transmembra
  • RSS
  • YouTube
  • Linkedin
  • Facebook