Product Browser
 
  • Related Product Showcase
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

CXCR4 monoclonal antibody (M01), clone 2H5   

  • Catalog # : H00007852-M01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CXCR4.
  • Immunogen:
  • CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007852-M01
    Western Blot detection against Immunogen (30.8 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CXCR4 expression in transfected 293T cell line by CXCR4 monoclonal antibody (M01), clone 2H5.

    Lane 1: CXCR4 transfected lysate(40.48 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7852
  • Gene Name:
  • CXCR4
  • Gene Alias:
  • CD184,D2S201E,FB22,HM89,HSY3RR,LAP3,LCR1,LESTR,NPY3R,NPYR,NPYRL,NPYY3R,WHIM
  • Gene Description:
  • chemokine (C-X-C motif) receptor 4
  • Gene Summary:
  • This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • C-X-C chemokine receptor type 4,CD184 antigen,chemokine (C-X-C motif), receptor 4 (fusin),chemokine receptor 4,fusin,leukocyte-derived seven-transmembrane-domain receptor,lipopolysaccharide-associated protein 3,neuropeptide Y receptor Y3,seven transmembra
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!