XRCC5 monoclonal antibody (M02), clone 3D8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant XRCC5.
Immunogen
XRCC5 (AAH19027.1, 1 a.a. ~ 732 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADSLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGIALITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (78)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (106.26 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
XRCC5 monoclonal antibody (M02), clone 3D8. Western Blot analysis of XRCC5 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of XRCC5 expression in transfected 293T cell line by XRCC5 monoclonal antibody (M02), clone 3D8.
Lane 1: XRCC5 transfected lysate(82.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to XRCC5 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged XRCC5 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to XRCC5 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — XRCC5
Entrez GeneID
7520GeneBank Accession#
BC019027Protein Accession#
AAH19027.1Gene Name
XRCC5
Gene Alias
FLJ39089, KARP-1, KARP1, KU80, KUB2, Ku86, NFIV
Gene Description
X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
Omim ID
194364Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. [provided by RefSeq
Other Designations
ATP-dependent DNA helicase II|DNA repair protein XRCC5|Ku autoantigen, 80kDa|Ku86 autoantigen related protein 1|X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining; Ku autoantigen, 80kD)|X-ray repair, comp
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Expression of Ku70 predicts results of radiotherapy in prostate cancer.
Hasegawa T,Someya M,Hori M,Matsumoto Y,Nakata K,Nojima M,Kitagawa M,Tsuchiya T,Masumori N,Hasegawa T,Sakata KI.
Strahlentherapie und Onkologie 2017 Jan; 193(1):29.
Application:IHC-P, Human, Prostate cancer.
-
Influence of XRCC4 expression in esophageal cancer cells on the response to radiotherapy.
Hori M, Someya M, Matsumoto Y, Nakata K, Kitagawa M, Hasegawa T, Tsuchiya T, Fukushima Y, Gocho T, Sato Y, Ohnuma H, Kato J, Sugita S, Hasegawa T, Sakata KI.
Medical Molecular Morphology 2016 Jun; [Epub].
Application:IHC-P, Human, Esophageal cancer tissues.
-
Serum anti-Ku86 is a potential biomarker for early detection of hepatitis C virus-related hepatocellular carcinoma.
Nomura F, Sogawa K, Noda K, Seimiya M, Matsushita K, Miura T, Tomonaga T, Yoshitomi H, Imazeki F, Takizawa H, Mogushi K, Miyazaki M, Yokosuka O.
Biochemical and Biophysical Research Communications 2012 May; 421(4):837.
Application:Quant, Human, Serum from patients with HCV-related chronic liver diseases, HCC, other gastrointestinal cancers and in healthy volunteers.
-
Expression of Ku70 predicts results of radiotherapy in prostate cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com