- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Proteins/Peptides > Human > Partial-length > Signal Transduction > WNT5A (Human) Recombinant Protein (Q01)
WNT5A (Human) Recombinant Protein (Q01)
- Catalog # : H00007474-Q01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 10 ug
- USD $ 319
- order now, ship next day
-
- 25 ug
- USD $ 485
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Human WNT5A partial ORF ( AAH64694, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.
- Sequence:
- ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
- Theoretical MW (kDa):
- 36.74
- Preparation Method:
- in vitro wheat germ expression system
- Purification:
- Glutathione Sepharose 4 Fast Flow
- Quality Control Testing:
- 12.5% SDS-PAGE Stained with Coomassie Blue.
- Storage Buffer:
- 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
- Storage Instruction:
- Store at -80°C. Aliquot to avoid repeated freezing and thawing.
- Note:
- Best use within three months from the date of receipt of this protein.
- MSDS:
Download
- Application Image
- Enzyme-linked Immunoabsorbent Assay
- Western Blot (Recombinant protein)
- Antibody Production
- Protein Array
- Entrez GeneID:
- 7474
- GeneBank Accession#:
- BC064694
- Protein Accession#:
- AAH64694
- Gene Name:
- WNT5A
- Gene Alias:
- hWNT5A
- Gene Description:
- wingless-type MMTV integration site family, member 5A
- Omim ID:
- 164975
- Gene Ontology:
- Hyperlink
- Gene Summary:
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. [provided by RefSeq
- Other Designations:
- WNT-5A protein
