VTN purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
VTN MaxPab polyclonal antibody. Western Blot analysis of VTN expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of VTN expression in transfected 293T cell line (H00007448-T01) by VTN MaxPab polyclonal antibody.
Lane 1: VTN transfected lysate(52.58 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human VTN protein.
Immunogen
VTN (AAH05046.1, 1 a.a. ~ 478 a.a) full-length human protein.
Sequence
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
VTN MaxPab polyclonal antibody. Western Blot analysis of VTN expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of VTN expression in transfected 293T cell line (H00007448-T01) by VTN MaxPab polyclonal antibody.
Lane 1: VTN transfected lysate(52.58 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — VTN
Entrez GeneID
7448GeneBank Accession#
BC005046.1Protein Accession#
AAH05046.1Gene Name
VTN
Gene Alias
V75, VN, VNT
Gene Description
vitronectin
Omim ID
193190Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. [provided by RefSeq
Other Designations
complement S-protein|epibolin|serum spreading factor|somatomedin B|vitronectin (serum spreading factor, somatomedin B, complement S-protein)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com