UNG purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
UNG MaxPab rabbit polyclonal antibody. Western Blot analysis of UNG expression in mouse liver.
Western Blot (Transfected lysate)
Western Blot analysis of UNG expression in transfected 293T cell line (H00007374-T01) by UNG MaxPab polyclonal antibody.
Lane 1: UNG transfected lysate(33.90 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human UNG protein.
Immunogen
UNG (NP_003353.1, 1 a.a. ~ 304 a.a) full-length human protein.
Sequence
MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
UNG MaxPab rabbit polyclonal antibody. Western Blot analysis of UNG expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of UNG expression in transfected 293T cell line (H00007374-T01) by UNG MaxPab polyclonal antibody.
Lane 1: UNG transfected lysate(33.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — UNG
Entrez GeneID
7374GeneBank Accession#
NM_003362Protein Accession#
NP_003353.1Gene Name
UNG
Gene Alias
DGU, DKFZp781L1143, HIGM4, UDG, UNG1, UNG15, UNG2
Gene Description
uracil-DNA glycosylase
Gene Ontology
HyperlinkGene Summary
This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. [provided by RefSeq
Other Designations
uracil-DNA glycosylase 1, uracil-DNA glycosylase 2|uracil-DNA glycosylase 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com