Product Browser

Last updated: 2014/9/1
  • Related Product Showcase
  • By Antibody/Protein

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UGT2B15 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00007366-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human UGT2B15 protein.
  • Immunogen:
  • UGT2B15 (AAI46571.1, 1 a.a. ~ 530 a.a) full-length human protein.
  • Sequence:
  • MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • UGT2B15 MaxPab rabbit polyclonal antibody. Western Blot analysis of UGT2B15 expression in human liver.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of UGT2B15 expression in transfected 293T cell line (H00007366-T02) by UGT2B15 MaxPab polyclonal antibody.

    Lane 1: UGT2B15 transfected lysate(58.3 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of UGT2B15 transfected lysate using anti-UGT2B15 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with UGT2B15 purified MaxPab mouse polyclonal antibody (B01P) (H00007366-B01P).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 7366
  • Gene Name:
  • UGT2B15
  • Gene Alias:
  • UGT2B8
  • Gene Description:
  • UDP glucuronosyltransferase 2 family, polypeptide B15
  • Gene Summary:
  • The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. See UGT2B4 (MIM 600067).[supplied by OMIM
  • Other Designations:
  • UDP glycosyltransferase 2 family, polypeptide B15,UDP-glucuronosyltransferase UGT2B15,UDP-glucuronyltransferase, family 2, beta-15
  • RSS
  • YouTube
  • Linkedin
  • Facebook