Product Browser

Last updated: 2014/9/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE2H (Human) Recombinant Protein (P01)

  • Catalog # : H00007328-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UBE2H full-length ORF ( AAH06277, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.87
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007328-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7328
  • Gene Name:
  • UBE2H
  • Gene Alias:
  • E2-20K,UBC8,UBCH,UBCH2
  • Gene Description:
  • ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast)
  • Gene Summary:
  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq
  • Other Designations:
  • ubiquitin carrier protein H,ubiquitin-conjugating enzyme E2H,ubiquitin-conjugating enzyme E2H (homologous to yeast UBC8),ubiquitin-protein ligase H
  • RSS
  • YouTube
  • Linkedin
  • Facebook