TYMS MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of TYMS expression in transfected 293T cell line (H00007298-T02) by TYMS MaxPab polyclonal antibody.
Lane 1: TYMS transfected lysate(35.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TYMS transfected lysate using anti-TYMS MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TYMS purified MaxPab mouse polyclonal antibody (B01P) (H00007298-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TYMS protein.
Immunogen
TYMS (AAH13919.1, 1 a.a. ~ 313 a.a) full-length human protein.
Sequence
MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TYMS expression in transfected 293T cell line (H00007298-T02) by TYMS MaxPab polyclonal antibody.
Lane 1: TYMS transfected lysate(35.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TYMS transfected lysate using anti-TYMS MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TYMS purified MaxPab mouse polyclonal antibody (B01P) (H00007298-B01P). -
Gene Info — TYMS
Entrez GeneID
7298GeneBank Accession#
NM_001071.1Protein Accession#
AAH13919.1Gene Name
TYMS
Gene Alias
HsT422, MGC88736, TMS, TS, TSase
Gene Description
thymidylate synthetase
Omim ID
188350Gene Ontology
HyperlinkGene Summary
Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occuring antisense transcript rTSalpha (GeneID:55556) vary inversely when cell-growth progresses from late-log to plateau phase. [provided by RefSeq
Other Designations
Thymidylate synthase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com