TUBB2A monoclonal antibody (M03), clone 2B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant TUBB2A.
Immunogen
TUBB2A (AAH01194, 1 a.a. ~ 445 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (74.47 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TUBB2A monoclonal antibody (M03), clone 2B2. Western Blot analysis of TUBB2A expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
TUBB2A monoclonal antibody (M03), clone 2B2. Western Blot analysis of TUBB2A expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
TUBB2A monoclonal antibody (M03), clone 2B2. Western Blot analysis of TUBB2A expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
TUBB2A monoclonal antibody (M03), clone 2B2. Western Blot analysis of TUBB2A expression in Raw 264.7(Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TUBB2A expression in transfected 293T cell line by TUBB2A monoclonal antibody (M03), clone 2B2.
Lane 1: TUBB2A transfected lysate(49.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TUBB2A is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TUBB2A on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TUBB2A
-
Interactome
-
Pathway
-
Publication Reference
-
Multi-chaperone function modulation and association with cytoskeletal proteins are key features of the function of AIP in the pituitary gland.
Hernández-Ramírez LC, Morgan RML, Barry S, D'Acquisto F, Prodromou C, Korbonits M.
Oncotarget 2018 Jan; 9(10):9177.
Application:IF, WB-Tr, Human, HEK 293 cells.
-
Multi-chaperone function modulation and association with cytoskeletal proteins are key features of the function of AIP in the pituitary gland.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com