TRIP6 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TRIP6 protein.
Immunogen
TRIP6 (NP_003293.2, 1 a.a. ~ 476 a.a) full-length human protein.
Sequence
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TRIP6 MaxPab polyclonal antibody. Western Blot analysis of TRIP6 expression in MES-SA/Dx5.Western Blot (Transfected lysate)
Western Blot analysis of TRIP6 expression in transfected 293T cell line (H00007205-T01) by TRIP6 MaxPab polyclonal antibody.
Lane 1: TRIP6 transfected lysate(52.36 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TRIP6
Entrez GeneID
7205GeneBank Accession#
NM_003302.2Protein Accession#
NP_003293.2Gene Name
TRIP6
Gene Alias
MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP1, ZRP-1
Gene Description
thyroid hormone receptor interactor 6
Omim ID
602933Gene Ontology
HyperlinkGene Summary
This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
Other Designations
OPA-interacting protein 1|thyroid receptor-interacting protein 6|zyxin related protein 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com