Product Browser

Last updated: 2014/9/22
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TK1 polyclonal antibody (A02)

  • Catalog # : H00007083-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TK1.
  • Immunogen:
  • TK1 (NP_003249, 157 a.a. ~ 234 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • FREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007083-A02
    Western Blot detection against Immunogen (34.69 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7083
  • Gene Name:
  • TK1
  • Gene Alias:
  • TK2
  • Gene Description:
  • thymidine kinase 1, soluble
  • Other Designations:
  • thymidine kinase 1 soluble isoform,thymidine kinase-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook