TIA1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TIA1 MaxPab polyclonal antibody. Western Blot analysis of TIA1 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of TIA1 expression in transfected 293T cell line (H00007072-T01) by TIA1 MaxPab polyclonal antibody.
Lane 1: TIA1 transfected lysate(23.54 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TIA1 protein.
Immunogen
TIA1 (AAH15944.1, 1 a.a. ~ 214 a.a) full-length human protein.
Sequence
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TIA1 MaxPab polyclonal antibody. Western Blot analysis of TIA1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of TIA1 expression in transfected 293T cell line (H00007072-T01) by TIA1 MaxPab polyclonal antibody.
Lane 1: TIA1 transfected lysate(23.54 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TIA1
Entrez GeneID
7072GeneBank Accession#
BC015944Protein Accession#
AAH15944.1Gene Name
TIA1
Gene Alias
-
Gene Description
TIA1 cytotoxic granule-associated RNA binding protein
Omim ID
603518Gene Ontology
HyperlinkGene Summary
The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms of this gene product has been described in the literature. [provided by RefSeq
Other Designations
T-cell-restricted intracellular antigen-1|TIA1 cytotoxic granule-associated RNA-binding protein|TIA1 protein|cytotoxic granule-associated RNA-binding protein|nucleolysin TIA-1 isoform p40|p40-TIA-1 (containing p15-TIA-1)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com