TAZ monoclonal antibody (M13), clone 1F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TAZ monoclonal antibody (M13), clone 1F11. Western Blot analysis of TAZ expression in human tongue.
Western Blot (Cell lysate)
TAZ monoclonal antibody (M13), clone 1F11. Western Blot analysis of TAZ expression in HL-60 ( Cat # L014V1 ).
Western Blot (Cell lysate)
TAZ monoclonal antibody (M13), clone 1F11. Western Blot analysis of TAZ expression in FHs 173 WE.
Western Blot detection against Immunogen (54.56 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TAZ.
Immunogen
TAZ (AAH11515, 1 a.a. ~ 262 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.56 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TAZ monoclonal antibody (M13), clone 1F11. Western Blot analysis of TAZ expression in human tongue.Western Blot (Cell lysate)
TAZ monoclonal antibody (M13), clone 1F11. Western Blot analysis of TAZ expression in HL-60 ( Cat # L014V1 ).Western Blot (Cell lysate)
TAZ monoclonal antibody (M13), clone 1F11. Western Blot analysis of TAZ expression in FHs 173 WE.Western Blot (Recombinant protein)
ELISA
-
Gene Info — TAZ
Entrez GeneID
6901GeneBank Accession#
BC011515Protein Accession#
AAH11515Gene Name
TAZ
Gene Alias
BTHS, CMD3A, EFE, EFE2, FLJ27390, G4.5, LVNCX, Taz1, XAP-2
Gene Description
tafazzin
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known. [provided by RefSeq
Other Designations
OTTHUMP00000031946|OTTHUMP00000031947|OTTHUMP00000031948|OTTHUMP00000031949|OTTHUMP00000061673
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com