ELOVL4 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ELOVL4 partial ORF ( NP_073563, 99 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.9
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ELOVL4
Entrez GeneID
6785GeneBank Accession#
NM_022726Protein Accession#
NP_073563Gene Name
ELOVL4
Gene Alias
ADMD, FLJ17667, FLJ92876, STGD2, STGD3
Gene Description
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4
Gene Ontology
HyperlinkGene Summary
This gene encodes a membrane-bound protein which is a member of the ELO family, proteins which participate in the biosynthesis of fatty acids. Consistent with the expression of the encoded protein in photoreceptor cells of the retina, mutations and small deletions in this gene are associated with Stargardt-like macular dystrophy (STGD3) and autosomal dominant Stargardt-like macular dystrophy (ADMD), also referred to as autosomal dominant atrophic macular degeneration. [provided by RefSeq
Other Designations
OTTHUMP00000016776|Stargardt disease 3 (autosomal dominant)|elongation of very long chain fatty acids-like 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com