Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

SSX4 purified MaxPab mouse polyclonal antibody (B01P)   MaxPab

  • Catalog # : H00006759-B01P
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SSX4 protein.
  • Immunogen:
  • SSX4 (NP_005627.1, 1 a.a. ~ 188 a.a) full-length human protein.
  • Sequence:
  • MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SSX4 expression in transfected 293T cell line (H00006759-T01) by SSX4 MaxPab polyclonal antibody.

    Lane 1: SSX4 transfected lysate(20.68 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 6759
  • Gene Name:
  • SSX4
  • Gene Alias:
  • MGC119056,MGC12411
  • Gene Description:
  • synovial sarcoma, X breakpoint 4
  • Gene Summary:
  • The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4, represents the more telomeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000024292
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!