Product Browser

Last updated: 2014/10/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SOX4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006659-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SOX4 partial ORF ( NP_003098, 45 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.86
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006659-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6659
  • Gene Name:
  • SOX4
  • Gene Alias:
  • EVI16
  • Gene Description:
  • SRY (sex determining region Y)-box 4
  • Gene Summary:
  • This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000039358,SRY-related HMG-box gene 4,ecotropic viral integration site 16
  • RSS
  • YouTube
  • Linkedin
  • Facebook