SOD2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SOD2 full-length ORF ( AAH12423.1, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
49.94
Interspecies Antigen Sequence
Mouse (90); Rat (88)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SOD2
Entrez GeneID
6648GeneBank Accession#
BC012423Protein Accession#
AAH12423.1Gene Name
SOD2
Gene Alias
IPO-B, MNSOD, Mn-SOD
Gene Description
superoxide dismutase 2, mitochondrial
Omim ID
147460Gene Ontology
HyperlinkGene Summary
This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
Mn superoxide dismutase|OTTHUMP00000017530|OTTHUMP00000017531|indophenoloxidase B|manganese superoxide dismutase|manganese-containing superoxide dismutase|mangano-superoxide dismutase
-
Interactome
-
Disease
-
Publication Reference
-
Identification of tumor antigens in human lung squamous carcinoma by serological proteome analysis.
Yang F, Xiao ZQ, Zhang XZ, Li C, Zhang PF, Li MY, Chen Y, Zhu GQ, Sun Y, Liu YF, Chen ZC.
Journal of Proteome Research 2006 Dec; 6(2):751.
Application:ELISA, Human, Human lung squamous carcinoma.
-
Identification of tumor antigens in human lung squamous carcinoma by serological proteome analysis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com