SOD2 MaxPab mouse polyclonal antibody (B02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SOD2 protein.
Immunogen
SOD2 (NP_001019636, 1 a.a. ~ 222 a.a) full-length human protein.
Sequence
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Tissue lysate)
SOD2 MaxPab polyclonal antibody. Western Blot analysis of SOD2 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of SOD2 expression in transfected 293T cell line (H00006648-T02) by SOD2 MaxPab polyclonal antibody.
Lane 1: SOD2 transfected lysate(24.42 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SOD2
Entrez GeneID
6648GeneBank Accession#
NM_001024465Protein Accession#
NP_001019636Gene Name
SOD2
Gene Alias
IPO-B, MNSOD, Mn-SOD
Gene Description
superoxide dismutase 2, mitochondrial
Omim ID
147460Gene Ontology
HyperlinkGene Summary
This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
Mn superoxide dismutase|OTTHUMP00000017530|OTTHUMP00000017531|indophenoloxidase B|manganese superoxide dismutase|manganese-containing superoxide dismutase|mangano-superoxide dismutase
-
Interactome
-
Disease
-
Publication Reference
-
Compartmentalized oxidative stress in dopaminergic cell death induced by pesticides and complex I inhibitors: Distinct roles of superoxide anion and superoxide dismutases.
Rodriguez-Rocha H, Garcia-Garcia A, Pickett C, Sumin L, Jones J, Chen H, Webb B, Choi J, Zhou Y, Zimmerman MC, Franco R.
Free Radical Biology & Medicine 2013 Aug; 61:370.
Application:WB-Tr, Human, SK-N-SH cells.
-
Compartmentalized oxidative stress in dopaminergic cell death induced by pesticides and complex I inhibitors: Distinct roles of superoxide anion and superoxide dismutases.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com