SNTB2 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SNTB2 expression in transfected 293T cell line (H00006645-T01) by SNTB2 MaxPab polyclonal antibody.
Lane 1: SNTB2 transfected lysate(29.37 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SNTB2 protein.
Immunogen
SNTB2 (ENSP00000353686, 1 a.a. ~ 267 a.a) full-length human protein.
Sequence
MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRQN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SNTB2 expression in transfected 293T cell line (H00006645-T01) by SNTB2 MaxPab polyclonal antibody.
Lane 1: SNTB2 transfected lysate(29.37 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SNTB2
Entrez GeneID
6645GeneBank Accession#
ENST00000360496Protein Accession#
ENSP00000353686Gene Name
SNTB2
Gene Alias
D16S2531E, EST25263, SNT2B2, SNT3, SNTL
Gene Description
syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2)
Omim ID
600027Gene Ontology
HyperlinkGene Summary
Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. [provided by RefSeq
Other Designations
basic beta 2 syntrophin|dystrophin-associated protein A1, 59kD, basic component 2|syntrophin, beta 2 (dystrophin-associated protein A1, 59kD, basic component 2)|syntrophin-like
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com