SNAI1 monoclonal antibody (M10), clone 2G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SNAI1.
Immunogen
SNAI1 (NP_005976.2, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (91)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SNAI1 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence (Circulating Tumor Cell)
HCC36 cells were stained with SNAI1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to SNAI1 on U-2 OS cell. [antibody concentration 10 ug/ml] -
Gene Info — SNAI1
Entrez GeneID
6615GeneBank Accession#
NM_005985Protein Accession#
NP_005976.2Gene Name
SNAI1
Gene Alias
SLUGH2, SNA, SNAH, dJ710H13.1
Gene Description
snail homolog 1 (Drosophila)
Omim ID
604238Gene Ontology
HyperlinkGene Summary
The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. [provided by RefSeq
Other Designations
OTTHUMP00000031680|snail 1 homolog|snail 1 zinc finger protein|snail 1, zinc finger protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A novel long non-coding RNA linc-ZNF469-3 promotes lung metastasis through miR-574-5p-ZEB1 axis in triple negative breast cancer.
Wang PS, Chou CH, Lin CH, Yao YC, Cheng HC, Li HY, Chuang YC, Yang CN, Ger LP, Chen YC, Lin FC, Shen TL, Hsiao M, Lu PJ.
Oncogene 2018 Aug; 37(34):4662.
Application:WB-Tr, Human, MDA-MB-231 vector, MDA-MB-231 linc-ZNF469-3, LM2-4175 sgControl, LM2-4175 sglinc-ZNF469-3 cells.
-
Isolation and characterization of a population of stem-like progenitor cells from an atypical meningioma.
Rath P, Miller DC, Litofsky NS, Anthony DC, Feng Q, Franklin C, Pei L, Free A, Liu J, Ren M, Kirk MD, Shi H.
Experimental and Molecular Pathology 2011 Apr; 90(2):179.
Application:IHC, Mouse, Meningioma tumors.
-
A novel long non-coding RNA linc-ZNF469-3 promotes lung metastasis through miR-574-5p-ZEB1 axis in triple negative breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com