Product Browser

Last updated: 2014/11/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SNAI2 monoclonal antibody (M07), clone 2E10

  • Catalog # : H00006591-M07
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant SNAI2.
  • Immunogen:
  • SNAI2 (NP_003059, 69 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00006591-M07
    Western Blot detection against Immunogen (32.78 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SNAI2 is approximately 0.3ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 6591
  • Gene Name:
  • SNAI2
  • Gene Alias:
  • MGC10182,SLUG,SLUGH1,WS2D
  • Gene Description:
  • snail homolog 2 (Drosophila)
  • Gene Summary:
  • This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000195093,neural crest transcription factor SLUG,slug (chicken homolog), zinc finger protein,slug homolog, zinc finger protein,snail 2
  • Gene Pathway
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook