SKP1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SKP1 protein.
Immunogen
SKP1 (NP_008861.2, 1 a.a. ~ 160 a.a) full-length human protein.
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SKP1 expression in transfected 293T cell line (H00006500-T02) by SKP1 MaxPab polyclonal antibody.
Lane 1: SKP1 transfected lysate(18.10 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between SKP1 and CACYBP. HeLa cells were stained with anti-SKP1 rabbit purified polyclonal 1:1200 and anti-CACYBP mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — SKP1
Entrez GeneID
6500GeneBank Accession#
NM_006930.2Protein Accession#
NP_008861.2Gene Name
SKP1
Gene Alias
EMC19, MGC34403, OCP-II, OCP2, SKP1A, TCEB1L, p19A
Gene Description
S-phase kinase-associated protein 1
Omim ID
601434Gene Ontology
HyperlinkGene Summary
This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq
Other Designations
RNA polymerase II elongation factor-like protein OCP2|cyclin A/CDK2-associated p19|organ of Corti protein 2|transcription elongation factor B (SIII), polypeptide 1-like
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com