SIM2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SIM2 polyclonal antibody (A01), Lot # O51024JC01 Western Blot analysis of SIM2 expression in HepG2 ( Cat # L019V1 ).
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant SIM2.
Immunogen
SIM2 (NP_005060, 426 a.a. ~ 525 a.a) partial recombinant protein with GST tag.
Sequence
ESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLSTLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (84)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SIM2 polyclonal antibody (A01), Lot # O51024JC01 Western Blot analysis of SIM2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SIM2
Entrez GeneID
6493GeneBank Accession#
NM_005069Protein Accession#
NP_005060Gene Name
SIM2
Gene Alias
MGC119447, SIM, bHLHe15
Gene Description
single-minded homolog 2 (Drosophila)
Omim ID
600892Gene Ontology
HyperlinkGene Summary
SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on the mapping position, its potential function as transcriptional repressor and similarity to Drosophila sim, it is proposed that SIM2 may contribute to some specific Down syndrome phenotypes [provided by RefSeq
Other Designations
single-minded homolog 2|single-minded homolog 2, short isoform|transcription factor SIM2
-
Interactome
-
Disease
-
Publication Reference
-
Celastrol regulates multiple nuclear transcription factors belonging to HSP90's clients in a dose- and cell type-dependent way.
Zhang D, Xu L, Cao F, Wei T, Yang C, Uzan G, Peng B.
Cell Stress & Chaperones 2010 May; 15(6):939.
Application：WB-Ce, Human, MCF-7 cells.
-
Celastrol regulates multiple nuclear transcription factors belonging to HSP90's clients in a dose- and cell type-dependent way.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com