ST6GAL1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ST6GAL1 protein.
Immunogen
ST6GAL1 (NP_775324.1, 1 a.a. ~ 175 a.a) full-length human protein.
Sequence
MNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ST6GAL1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ST6GAL1 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of ST6GAL1 expression in transfected 293T cell line (H00006480-T02) by ST6GAL1 MaxPab polyclonal antibody.
Lane 1: ST6GAL1 transfected lysate(20.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ST6GAL1
Entrez GeneID
6480GeneBank Accession#
NM_173217.1Protein Accession#
NP_775324.1Gene Name
ST6GAL1
Gene Alias
CD75, MGC48859, SIAT1, ST6GalI, ST6N
Gene Description
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Omim ID
109675Gene Ontology
HyperlinkGene Summary
This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Three transcript variants encoding two different isoforms have been described. [provided by RefSeq
Other Designations
CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase|ST6Gal I|alpha 2,6-ST|sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase)|sialyltransferase 1 (beta-galactoside alpha-2,6-sialytransferase)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Loss of the Golgi Matrix Protein 130 Cause Aberrant IgA1 Glycosylation in IgA Nephropathy.
Wang C, Ye M, Zhao Q, Xia M, Liu D, He L, Chen G, Peng Y, Liu H.
American Journal of Nephrology 2019 Mar; 49(4):307.
Application:WB-Tr, Human, PBMCs.
-
Loss of the Golgi Matrix Protein 130 Cause Aberrant IgA1 Glycosylation in IgA Nephropathy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com