SHMT1 monoclonal antibody (M01), clone 4F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SHMT1.
Immunogen
SHMT1 (NP_004160, 374 a.a. ~ 482 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPD
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SHMT1 monoclonal antibody (M01), clone 4F9 Western Blot analysis of SHMT1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SHMT1 expression in transfected 293T cell line by SHMT1 monoclonal antibody (M01), clone 4F9.
Lane 1: SHMT1 transfected lysate(53.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SHMT1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — SHMT1
Entrez GeneID
6470GeneBank Accession#
NM_004169Protein Accession#
NP_004160Gene Name
SHMT1
Gene Alias
CSHMT, MGC15229, MGC24556, SHMT
Gene Description
serine hydroxymethyltransferase 1 (soluble)
Omim ID
182144Gene Ontology
HyperlinkGene Summary
This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
14 kDa protein|cytoplasmic serine hydroxymethyltransferase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Mass spectrometric/bioinformatic identification of a protein subset that characterizes the cellular activity of anticancer peptides.
Genovese F, Gualandi A, Taddia L, Marverti G, Pirondi S, Marraccini C, Perco P, Pela M, Guerrini R, Amoroso MR, Esposito F, Martello A, Ponterini G.
The Journal of Proteome Research 2014 Nov; 13(11):5250.
Application:WB-Ce, Human, CSD-OC, A2780/CP, IGROV-1 cells.
-
Mass spectrometric/bioinformatic identification of a protein subset that characterizes the cellular activity of anticancer peptides.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com