CCL15 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CCL15 expression in transfected 293T cell line (H00006359-T02) by CCL15 MaxPab polyclonal antibody.
Lane 1: CCL15 transfected lysate(12.20 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CCL15 transfected lysate using anti-CCL15 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCL15 MaxPab rabbit polyclonal antibody (D01) (H00006359-D01).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CCL15 protein.
Immunogen
CCL15 (NP_004158.2, 1 a.a. ~ 113 a.a) full-length human protein.
Sequence
MKVSVAALSCLMLVAVLGSQAQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCL15 expression in transfected 293T cell line (H00006359-T02) by CCL15 MaxPab polyclonal antibody.
Lane 1: CCL15 transfected lysate(12.20 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CCL15 transfected lysate using anti-CCL15 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CCL15 MaxPab rabbit polyclonal antibody (D01) (H00006359-D01). -
Gene Info — CCL15
Entrez GeneID
6359GeneBank Accession#
NM_004167Protein Accession#
NP_004158.2Gene Name
CCL15
Gene Alias
HCC-2, HMRP-2B, LKN1, Lkn-1, MIP-1d, MIP-5, NCC-3, NCC3, SCYA15, SCYL3, SY15
Gene Description
chemokine (C-C motif) ligand 15
Omim ID
601393Gene Ontology
HyperlinkGene Summary
This gene, CCL15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. Read-through transcripts are expressed that include exons from the downstream cytokine gene CCL14, and are represented as GeneID: 348249. [provided by RefSeq
Other Designations
CC chemokine 3|MIP-1 delta|OTTHUMP00000163955|chemokine CC-2|leukotactin 1|macrophage inflammatory protein 5|small inducible cytokine subfamily A (Cys-Cys), member 15
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com