CCL14 monoclonal antibody (M01), clone 1F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CCL14 expression in transfected 293T cell line by CCL14 monoclonal antibody (M01), clone 1F12.
Lane 1: CCL14 transfected lysate(10.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCL14 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.77 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CCL14.
Immunogen
CCL14 (AAH45165, 20 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.77 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCL14 expression in transfected 293T cell line by CCL14 monoclonal antibody (M01), clone 1F12.
Lane 1: CCL14 transfected lysate(10.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CCL14 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CCL14
Entrez GeneID
6358GeneBank Accession#
BC045165Protein Accession#
AAH45165Gene Name
CCL14
Gene Alias
CC-1, CC-3, CKb1, HCC-1, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14
Gene Description
chemokine (C-C motif) ligand 14
Omim ID
601392Gene Ontology
HyperlinkGene Summary
This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene CCL15, and are represented as GeneID: 348249. [provided by RefSeq
Other Designations
OTTHUMP00000176860|chemokine CC-1|chemokine CC-3|small inducible cytokine subfamily A (Cys-Cys), member 14
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com