CCL13 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CCL13 expression in transfected 293T cell line (H00006357-T01) by CCL13 MaxPab polyclonal antibody.
Lane 1: CCL13 transfected lysate(10.78 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CCL13 protein.
Immunogen
CCL13 (NP_005399.1, 1 a.a. ~ 98 a.a) full-length human protein.
Sequence
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CCL13 expression in transfected 293T cell line (H00006357-T01) by CCL13 MaxPab polyclonal antibody.
Lane 1: CCL13 transfected lysate(10.78 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CCL13
Entrez GeneID
6357GeneBank Accession#
NM_005408Protein Accession#
NP_005399.1Gene Name
CCL13
Gene Alias
CKb10, MCP-4, MGC17134, NCC-1, NCC1, SCYA13, SCYL1
Gene Description
chemokine (C-C motif) ligand 13
Omim ID
601391Gene Ontology
HyperlinkGene Summary
This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq
Other Designations
CK-beta-10|monocyte chemoattractant protein 4|monocyte chemotactic protein 4|new CC chemokine 1|small inducible cytokine A13|small inducible cytokine subfamily A (Cys-Cys), member 13
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com