CCL1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CCL1 partial ORF ( NP_002972, 24 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.77
Interspecies Antigen Sequence
Mouse (38); Rat (41)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCL1
Entrez GeneID
6346GeneBank Accession#
NM_002981Protein Accession#
NP_002972Gene Name
CCL1
Gene Alias
I-309, P500, SCYA1, SISe, TCA3
Gene Description
chemokine (C-C motif) ligand 1
Omim ID
182281Gene Ontology
HyperlinkGene Summary
This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq
Other Designations
T lymphocyte-secreted protein I-309|inflammatory cytokine I-309|small inducible cytokine A1|small inducible cytokine A1 (I-309, homologous to mouse Tca-3)
-
Interactome
-
Pathway
-
Disease
- Adenocarcinoma
- Arthritis
- Asthma
- Atherosclerosis
- Birth Weight
- Breast cancer
- Breast Neoplasms
- Bronchiolitis
- Colon cancer
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com