Product Browser

Last updated: 2014/7/28

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00006346-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL1 partial ORF ( NP_002972, 24 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.77
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00006346-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6346
  • Gene Name:
  • CCL1
  • Gene Alias:
  • I-309,P500,SCYA1,SISe,TCA3
  • Gene Description:
  • chemokine (C-C motif) ligand 1
  • Gene Summary:
  • This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine receptor CCR8. [provided by RefSeq
  • Other Designations:
  • T lymphocyte-secreted protein I-309,inflammatory cytokine I-309,small inducible cytokine A1,small inducible cytokine A1 (I-309, homologous to mouse Tca-3)
  • RSS
  • YouTube
  • Linkedin
  • Facebook