SCT purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SCT MaxPab rabbit polyclonal antibody. Western Blot analysis of SCT expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of SCT expression in transfected 293T cell line (H00006343-T02) by SCT MaxPab polyclonal antibody.
Lane 1: SCT transfected lysate(13.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SCT protein.
Immunogen
SCT (NP_068739.1, 1 a.a. ~ 121 a.a) full-length human protein.
Sequence
MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SCT MaxPab rabbit polyclonal antibody. Western Blot analysis of SCT expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of SCT expression in transfected 293T cell line (H00006343-T02) by SCT MaxPab polyclonal antibody.
Lane 1: SCT transfected lysate(13.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SCT
Entrez GeneID
6343GeneBank Accession#
NM_021920.2Protein Accession#
NP_068739.1Gene Name
SCT
Gene Alias
-
Gene Description
secretin
Omim ID
182099Gene Ontology
HyperlinkGene Summary
Secretin belongs to the glucagon family. This protein is an endocrine hormone and its major site of production is the endocrine S cells located in the proximal small intestinal mucosa. The release of active secretin is stimulated by either fatty acids or an acidic pH in the duodenum. This hormone stimulates the secretion of bicarbonate-rich pancreatic fluids and has also been shown to regulate the growth and development of the stomach, small intestine, and pancreas. Secretin deficiency has been implicated in autistic syndrome, suggesting that the hormone could have a neuroendocrine function in addition to its role in digestion. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com