SAFB monoclonal antibody (M04), clone 5A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SAFB monoclonal antibody (M04), clone 5A11 Western Blot analysis of SAFB expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SAFB on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SAFB is approximately 0.1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SAFB on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.64 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SAFB.
Immunogen
SAFB (NP_002958, 111 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SAFB monoclonal antibody (M04), clone 5A11 Western Blot analysis of SAFB expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SAFB on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SAFB is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SAFB on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SAFB
Entrez GeneID
6294GeneBank Accession#
NM_002967Protein Accession#
NP_002958Gene Name
SAFB
Gene Alias
DKFZp779C1727, HAP, HET, SAFB1
Gene Description
scaffold attachment factor B
Omim ID
602895Gene Ontology
HyperlinkGene Summary
This gene encodes a DNA-binding protein that has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. This encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of the heat shock protein 27 transcription and also can act as an estrogen receptor corepressor. This gene is a candidate gene for breast tumorigenesis. [provided by RefSeq
Other Designations
HSP27 ERE-TATA-binding protein|Hsp27 ERE-TATA binding protein|glutathione S-transferase fusion protein|heat-shock protein (HSP27) estrogen response element and TATA box-binding protein|scaffold attachment factor B1
-
Interactome
-
Publication Reference
-
A novel class of microRNA-recognition elements that function only within open reading frames.
Zhang K, Zhang X, Cai Z, Zhou J, Cao R, Zhao Y, Chen Z, Wang D, Ruan W, Zhao Q, Liu G, Xue Y, Qin Y, Zhou B, Wu L, Nilsen T, Zhou Y, Fu XD.
Nature Structural & Molecular Biology 2018 Nov; 25(11):1019.
Application：WB-Tr, Human, HeLa cells.
-
A novel class of microRNA-recognition elements that function only within open reading frames.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com