- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
- By Disease
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Monoclonal Ab > Human > Apoptosis > S100B monoclonal antibody (M03), clone 1B2
S100B monoclonal antibody (M03), clone 1B2
- Catalog # : H00006285-M03
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse monoclonal antibody raised against a partial recombinant S100B.
- Immunogen:
- S100B (NP_006263, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Sequence:
- MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
- Host:
- Mouse
- Reactivity:
- Human
- Isotype:
- IgG1 Kappa
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.86 KDa) .
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Applications
- Western Blot (Cell lysate)
- S100B monoclonal antibody (M03), clone 1B2. Western Blot analysis of S100B expression in HepG2 ( Cat # L019V1 ).
- Protocol Download
- Western Blot (Recombinant protein)
- Protocol Download
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
enlarge this image- Immunoperoxidase of monoclonal antibody to S100B on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Protocol Download
- Sandwich ELISA (Recombinant protein)
- Detection limit for recombinant GST tagged S100B is 0.03 ng/ml as a capture antibody.
- Protocol Download
- Entrez GeneID:
- 6285
- GeneBank Accession#:
- NM_006272
- Protein Accession#:
- NP_006263
- Gene Name:
- S100B
- Gene Alias:
- NEF,S100,S100beta
- Gene Description:
- S100 calcium binding protein B
- Omim ID:
- 176990
- Gene Ontology:
- Hyperlink
- Gene Summary:
- The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. [provided by RefSeq
- Other Designations:
- OTTHUMP00000174958,S-100 calcium-binding protein, beta chain,S100 beta,S100 calcium binding protein, beta (neural),S100 calcium-binding protein, beta,S100 calcium-binding protein, beta (neural)
