S100A8 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human S100A8 full-length ORF ( AAH05928.1, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.97
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — S100A8
Entrez GeneID
6279GeneBank Accession#
BC005928Protein Accession#
AAH05928.1Gene Name
S100A8
Gene Alias
60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8
Gene Description
S100 calcium binding protein A8
Omim ID
123885Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. [provided by RefSeq
Other Designations
OTTHUMP00000015329|OTTHUMP00000015330|S100 calcium-binding protein A8|S100 calcium-binding protein A8 (calgranulin A)|calgranulin A|cystic fibrosis antigen
-
Interactome
-
Disease
-
Publication Reference
-
Melanocyte and melanoma cell activation by calprotectin.
Shirley SH, von Maltzan K, Robbins PO, Kusewitt DF.
Journal of Skin Cancer 2014 Aug; 2014:846249.
Application:Cell Proliferation Assay, Human, Melanocyte, Melanoma cells.
-
Predictive significance of kidney myeloid-related protein 8 expression in patients with obesity- or type 2 diabetes-associated kidney diseases.
Kuwabara T, Mori K, Kasahara M, Yokoi H, Imamaki H, Ishii A, Koga K, Sugawara A, Yasuno S, Ueshima K, Morikawa T, Konishi Y, Imanishi M, Nishiyama A, Nakao K, Mukoyama M.
PLoS One 2014 Feb; 9(2):e88942.
Application:Incubated, Recombinant protein.
-
In vivo targeting of inflammation-associated myeloid-related protein 8/14 via gadolinium immunonanoparticles.
Maiseyeu A, Badgeley MA, Kampfrath T, Mihai G, Deiuliis JA, Liu C, Sun Q, Parthasarathy S, Simon DI, Croce K, Rajagopalan S.
Arteriosclerosis, Thrombosis, and Vascular Biology 2012 Apr; 32(4):962.
-
Chemotactic Activity of S100A7 (Psoriasin) Is Mediated by the Receptor for Advanced Glycation End Products and Potentiates Inflammation with Highly Homologous but Functionally Distinct S100A15.
Wolf R, Howard OM, Dong HF, Voscopoulos C, Boeshans K, Winston J, Divi R, Gunsior M, Goldsmith P, Ahvazi B, Chavakis T, Oppenheim JJ, Yuspa SH.
Journal of Immunology 2008 Jul; 181(2):1499.
-
Cationic polypeptides are required for anti-HIV-1 activity of human vaginal fluid.
Venkataraman N, Cole AL, Svoboda P, Pohl J, Cole AM.
Journal of Immunology 2005 Dec; 175(11):7560.
Application:WB, Human, Human vaginal fluid.
-
Melanocyte and melanoma cell activation by calprotectin.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com