S100A8 purified MaxPab rabbit polyclonal antibody (D02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human S100A8 protein.
Immunogen
S100A8 (NP_002955.2, 1 a.a. ~ 93 a.a) full-length human protein.
Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
S100A8 MaxPab rabbit polyclonal antibody. Western Blot analysis of S100A8 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of S100A8 expression in transfected 293T cell line (H00006279-T04) by S100A8 MaxPab polyclonal antibody.
Lane 1: S100A8 transfected lysate(10.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — S100A8
Entrez GeneID
6279GeneBank Accession#
NM_002964.3Protein Accession#
NP_002955.2Gene Name
S100A8
Gene Alias
60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8
Gene Description
S100 calcium binding protein A8
Omim ID
123885Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. [provided by RefSeq
Other Designations
OTTHUMP00000015329|OTTHUMP00000015330|S100 calcium-binding protein A8|S100 calcium-binding protein A8 (calgranulin A)|calgranulin A|cystic fibrosis antigen
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com