Product Browser

Last updated: 2014/7/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

S100A8 MaxPab mouse polyclonal antibody (B02)MaxPab

  • Catalog # : H00006279-B02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human S100A8 protein.
  • Immunogen:
  • S100A8 (NP_002955.2, 1 a.a. ~ 93 a.a) full-length human protein.
  • Sequence:
  • MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of S100A8 expression in transfected 293T cell line (H00006279-T04) by S100A8 MaxPab polyclonal antibody.

    Lane 1: S100A8 transfected lysate(10.80 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 6279
  • Gene Name:
  • S100A8
  • Gene Alias:
  • 60B8AG,CAGA,CFAG,CGLA,CP-10,L1Ag,MA387,MIF,MRP8,NIF,P8
  • Gene Description:
  • S100 calcium binding protein A8
  • Gene Summary:
  • The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000015329,OTTHUMP00000015330,S100 calcium-binding protein A8,S100 calcium-binding protein A8 (calgranulin A),calgranulin A,cystic fibrosis antigen
  • RSS
  • YouTube
  • Linkedin
  • Facebook