S100A7 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human S100A7 full-length ORF ( AAH34687.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.85
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — S100A7
Entrez GeneID
6278GeneBank Accession#
BC034687.1Protein Accession#
AAH34687.1Gene Name
S100A7
Gene Alias
PSOR1, S100A7c
Gene Description
S100 calcium binding protein A7
Omim ID
600353Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. [provided by RefSeq
Other Designations
OTTHUMP00000015327|OTTHUMP00000015328|S100 calcium-binding protein A7 (psoriasin 1)|psoriasin 1
-
Interactome
-
Disease
-
Publication Reference
-
HPV infection alters vaginal microbiome through down-regulating host mucosal innate peptides used by Lactobacilli as amino acid sources.
Alizee Lebeau, Diane Bruyere, Patrick Roncarati, Paul Peixoto, Eric Hervouet, Gael Cobraiville, Bernard Taminiau, Murielle Masson, Carmen Gallego, Gabriel Mazzucchelli, Nicolas Smargiasso, Maximilien Fleron, Dominique Baiwir, Elodie Hendrick, Charlotte Pilard, Thomas Lerho, Celia Reynders, Marie Ancion, Roland Greimers, Jean-Claude Twizere, Georges Daube, Geraldine Schlecht-Louf, Françoise Bachelerie, Jean-Damien Combes , Pierrette Melin, Marianne Fillet, Philippe Delvenne, Pascale Hubert, Micha
Nature Communications 2022 Feb; 13(1):1076.
Application：Sub, Bacteria, Garnerella vaginalis, Lactobacillus crispatus, Lactobacillus iners, Lactobacillus jensenii.
-
The Expression of Psoriasin (S100A7) and CD24 Is Linked and Related to the Differentiation of Mammary Epithelial Cells.
Vegfors J, Petersson S, Kovacs A, Polyak K, Enerback C.
PLoS One 2012 Dec; 7(12):e53119.
Application：Func, Human, MCF10A.
-
Psoriasin (S100A7) increases the expression of ROS and VEGF and acts through RAGE to promote endothelial cell proliferation.
Shubbar E, Vegfors J, Carlstrom M, Petersson S, Enerback C.
Breast Cancer Research and Treatment 2011 Dec; 134(1):71.
Application：Func, Human, HUVEC.
-
Use of a combination of approaches to identify and validate relevant tumor-associated antigens and their corresponding autoantibodies in ovarian cancer patients.
Gagnon A, Kim JH, Schorge JO, Ye B, Liu B, Hasselblatt K, Welch WR, Bandera CA, Mok SC.
Clinical Cancer Research 2008 Feb; 14(3):764.
Application：ELISA, Human, Serum from patients with benign gynecologic disease, and early- and late-stage ovarian cancer patients.
-
HPV infection alters vaginal microbiome through down-regulating host mucosal innate peptides used by Lactobacilli as amino acid sources.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com