S100A7 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human S100A7 protein.
Immunogen
S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length human protein.
Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of S100A7 expression in transfected 293T cell line (H00006278-T02) by S100A7 MaxPab polyclonal antibody.
Lane 1: S100A7 transfected lysate(11.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — S100A7
Entrez GeneID
6278GeneBank Accession#
NM_002963.2Protein Accession#
AAH34687.1Gene Name
S100A7
Gene Alias
PSOR1, S100A7c
Gene Description
S100 calcium binding protein A7
Omim ID
600353Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. [provided by RefSeq
Other Designations
OTTHUMP00000015327|OTTHUMP00000015328|S100 calcium-binding protein A7 (psoriasin 1)|psoriasin 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com