S100A7 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human S100A7 protein.
Immunogen
S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length human protein.
Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of S100A7 expression in transfected 293T cell line (H00006278-T01) by S100A7 MaxPab polyclonal antibody.
Lane 1: S100A7 transfected lysate(11.22 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to S100A7 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] -
Gene Info — S100A7
Entrez GeneID
6278GeneBank Accession#
BC034687Protein Accession#
AAH34687Gene Name
S100A7
Gene Alias
PSOR1, S100A7c
Gene Description
S100 calcium binding protein A7
Omim ID
600353Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. [provided by RefSeq
Other Designations
OTTHUMP00000015327|OTTHUMP00000015328|S100 calcium-binding protein A7 (psoriasin 1)|psoriasin 1
-
Interactome
-
Disease
-
Publication Reference
-
Overexpression of LEDGF/DFS70 Induces IL-6 via p38 Activation in HaCaT Cells, Similar to that Seen in the Psoriatic Condition.
Takuya Takeichi, Kazumitsu Sugiura, Yoshinao Muro, Kenji Matsumoto, Yasushi Ogawa, Kyoko Futamura, Osamu Kaminuma, Noriko Hashimoto, Yoshie Shimoyama, Hirohisa Saito, Yasushi Tomita.
The Journal of Investigative Dermatology 2010 Dec; 130(12):2760.
Application:WB-Tr, Human, HaCaT cells.
-
Overexpression of LEDGF/DFS70 Induces IL-6 via p38 Activation in HaCaT Cells, Similar to that Seen in the Psoriatic Condition.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com