S100A7 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant S100A7.
Immunogen
S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag.
Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.22 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — S100A7
Entrez GeneID
6278GeneBank Accession#
BC034687.1Protein Accession#
AAH34687.1Gene Name
S100A7
Gene Alias
PSOR1, S100A7c
Gene Description
S100 calcium binding protein A7
Omim ID
600353Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. [provided by RefSeq
Other Designations
OTTHUMP00000015327|OTTHUMP00000015328|S100 calcium-binding protein A7 (psoriasin 1)|psoriasin 1
-
Interactome
-
Disease
-
Publication Reference
-
Phosphoproteomic analysis reveals Smad protein family activation following Rift Valley fever virus infection.
de la Fuente C, Pinkham C, Dabbagh D, Beitzel B, Garrison A, Palacios G, Hodge KA, Petricoin EF, Schmaljohn C, Campbell CE, Narayanan A, Kehn-Hall K.
PLoS One 2018 Feb; 13(2):e0191983.
Application:AM, Human, Human small airway epithelial cells.
-
The Progestin Receptor Interactome in the Female Mouse Hypothalamus: Interactions with Synaptic Proteins Are Isoform Specific and Ligand Dependent.
Acharya KD, Nettles SA, Sellers KJ, Im DD, Harling M, Pattanayak C, Vardar-Ulu D, Lichti CF, Huang S, Edwards DP, Srivastava DP, Denner L, Tetel MJ.
eNeuro 2017 Sep; 4(5):ENEURO.027.
Application:Array, Mouse, Mouse brain.
-
The heme degradation pathway is a promising serum biomarker source for the early detection of Alzheimer's disease.
Mueller C, Zhou W, Vanmeter A, Heiby M, Magaki S, Ross MM, Espina V, Schrag M, Dickson C, Liotta LA, Kirsch WM.
Journal of Alzheimer's Disease 2010 Jan; 19(3):1081.
Application:Func, Human, Serum.
-
Phosphoproteomic analysis reveals Smad protein family activation following Rift Valley fever virus infection.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com