Product Browser

Last updated: 2014/9/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RXRA (Human) Recombinant Protein

  • Catalog # : H00006256-Q02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RXRA partial ORF (NP_002948.1, 27 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.89
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00006256-Q02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 6256
  • Gene Name:
  • RXRA
  • Gene Alias:
  • FLJ00280,FLJ00318,FLJ16020,FLJ16733,MGC102720,NR2B1
  • Gene Description:
  • retinoid X receptor, alpha
  • Gene Summary:
  • Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022510
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook