RPS4X monoclonal antibody (M01A), clone 3E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RPS4X.
Immunogen
RPS4X (NP_000998, 74 a.a. ~ 177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDT
Host
Mouse
Reactivity
Human
Isotype
IgM Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
ELISA
-
Gene Info — RPS4X
Entrez GeneID
6191GeneBank Accession#
NM_001007Protein Accession#
NP_000998Gene Name
RPS4X
Gene Alias
CCG2, DXS306, FLJ40595, SCAR, SCR10
Gene Description
ribosomal protein S4, X-linked
Omim ID
312760Gene Ontology
HyperlinkGene Summary
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes ribosomal protein S4, a component of the 40S subunit. Ribosomal protein S4 is the only ribosomal protein known to be encoded by more than one gene, namely this gene and ribosomal protein S4, Y-linked (RPS4Y). The 2 isoforms encoded by these genes are not identical, but are functionally equivalent. Ribosomal protein S4 belongs to the S4E family of ribosomal proteins. This gene is not subject to X-inactivation. It has been suggested that haploinsufficiency of the ribosomal protein S4 genes plays a role in Turner syndrome; however, this hypothesis is controversial. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
40S ribosomal protein S4, X isoform|OTTHUMP00000023537|cell cycle gene 2|ribosomal protein S4X isoform|single-copy abundant mRNA
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com