MRPS12 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MRPS12 protein.
Immunogen
MRPS12 (NP_066930, 1 a.a. ~ 138 a.a) full-length human protein.
Sequence
MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MRPS12 expression in transfected 293T cell line (H00006183-T01) by MRPS12 MaxPab polyclonal antibody.
Lane 1: MRPS12 transfected lysate(15.18 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MRPS12
Entrez GeneID
6183GeneBank Accession#
NM_021107Protein Accession#
NP_066930Gene Name
MRPS12
Gene Alias
MPR-S12, MT-RPS12, RPMS12, RPS12, RPSM12
Gene Description
mitochondrial ribosomal protein S12
Omim ID
603021Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5' UTR have been found for this gene; all three variants encode the same protein. [provided by RefSeq
Other Designations
ribosomal protein, mitochondrial, S12
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com